Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tubulin beta-4A chain (TUBB4A)

Product Specifications

Product Name Alternative

Tubulin 5 beta Tubulin beta-4 chain

Abbreviation

Recombinant Human TUBB4A protein

Gene Name

TUBB4A

UniProt

P04350

Expression Region

1-444aa

Organism

Homo sapiens (Human)

Target Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

Molecular Weight

53.6 kDa

References & Citations

"Sequence of an expressed human beta-tubulin gene containing ten Alu family members."Lee M.G.-S., Loomis C., Cowan N.J.Nucleic Acids Res. 12:5823-5836 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL5C siRNA (Mouse)
MBS8205575-01 15 nmol

ARL5C siRNA (Mouse)

Sign In for Pricing
View Details
ARL5C siRNA (Mouse)
MBS8205575-02 30 nmol

ARL5C siRNA (Mouse)

Sign In for Pricing
View Details
ARL5C siRNA (Mouse)
MBS8205575-03 5x 30 nmol

ARL5C siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant Human NHP2-Like Protein 1/NHP2L1 (N-6His)
32-7218-50 50 µg

Recombinant Human NHP2-Like Protein 1/NHP2L1 (N-6His)

Sign In for Pricing
View Details
Slc30a8 3'UTR Lenti-reporter-Luc Vector
44117084 1.0 µg

Slc30a8 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PSMF1 (NM_006814) Human Tagged ORF Clone
RC218938 10 µg

PSMF1 (NM_006814) Human Tagged ORF Clone

Sign In for Pricing
View Details