Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Interleukin-10 (IL10)

Product Specifications

Product Name Alternative

Cytokine synthesis inhibitory factor ; CSIF

Abbreviation

Recombinant Sheep IL10 protein

Gene Name

IL10

UniProt

Q29408

Expression Region

20-177aa

Organism

Ovis aries (Sheep)

Target Sequence

SRDASTLSDSSCTHFPASLPHMLRDVRAAFGKVKTFFQMKDQLNSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKRVFNMLQERGVYKAMSEFDIFINYIESYMTTKM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Molecular Weight

20.4 kDa

References & Citations

Sequence of the sheep interleukin-10-encoding cDNA.Dutia B.M., Hunt P., Sargan D.R., Dalziel R.G., Hopkins J.Gene 149:393-394 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom1r20 Protein Vector (Rat) (pPM-C-HA)
PV315340 500 ng

Vom1r20 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human TP53INP2 shRNA (UAS) - Lentiviral human TP53INP2 shRNA (UAS) plasmid
GTR15344182 1 Vial

Lentiviral human TP53INP2 shRNA (UAS) - Lentiviral human TP53INP2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse Anti-Human CD18 mAb (FITC)
orb2709785 100 Tests

Mouse Anti-Human CD18 mAb (FITC)

Sign In for Pricing
View Details
Anti-DBF4 Antibody Picoband® Fluoro550 Conjugated
A01348-2-Fluoro550 100 µg/Vial

Anti-DBF4 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Qtrt2 shRNA (UAS) - Lentiviral mouse Qtrt2 shRNA (UAS, RFP) (25)
GTR15276791 1 Vial

Lentiviral mouse Qtrt2 shRNA (UAS) - Lentiviral mouse Qtrt2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Maceneolignan H
HY-N10397 1 Each

Maceneolignan H

Sign In for Pricing
View Details