Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mucin-2 (MUC2), partial

Product Specifications

Product Name Alternative

Intestinal mucin-2

Abbreviation

Recombinant Human MUC2 protein, partial

Gene Name

MUC2

UniProt

Q02817

Expression Region

36-240aa

Organism

Homo sapiens (Human)

Target Sequence

VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Coats the epithelia of the intestines, airways, and other mucus mbrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.

Molecular Weight

24.8 kDa

References & Citations

In vivo glycosylation of mucin tandem repeats.Silverman H.S., Parry S., Sutton-Smith M., Burdick M.D., McDermott K., Reid C.J., Batra S.K., Morris H.R., Hollingsworth M.A., Dell A., Harris A.Glycobiology 11:459-471 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5, ACSB, ACSVL6, FACVL3, FATP5, FLJ22987, VLACSR, VLCS-H2, VLCSH2)
251731 100 µL

SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5, ACSB, ACSVL6, FACVL3, FATP5, FLJ22987, VLACSR, VLCS-H2, VLCSH2)

Sign In for Pricing
View Details
AZD-6605
HY-119185 1 Each

AZD-6605

Sign In for Pricing
View Details
CD26 Antibody, mAb, Rabbit
A03625-50 50 µL

CD26 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Dicer/DICER1 Rabbit Polyclonal Antibody (Fluoro647)
orb3119599 100 µg

Dicer/DICER1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
RPS4X (Ribosomal Protein S4, X-linked, S4, CCG2, RPS4, SCAR, SCR10, DXS306) discontinued
219208-01 20 µL

RPS4X (Ribosomal Protein S4, X-linked, S4, CCG2, RPS4, SCAR, SCR10, DXS306) discontinued

Sign In for Pricing
View Details
RPS4X (Ribosomal Protein S4, X-linked, S4, CCG2, RPS4, SCAR, SCR10, DXS306) discontinued
219208-02 100 µL

RPS4X (Ribosomal Protein S4, X-linked, S4, CCG2, RPS4, SCAR, SCR10, DXS306) discontinued

Sign In for Pricing
View Details