Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integrin alpha-V (ITGAV), partial

Product Specifications

Product Name Alternative

Vitronectin receptor subunit alpha; CD51

Abbreviation

Recombinant Human ITGAV protein, partial

Gene Name

ITGAV

UniProt

P06756

Expression Region

891-1048aa

Organism

Homo sapiens (Human)

Target Sequence

DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with Extracellular domain viral Tat protein ses to enhance angiogenesis in Kaposi's sarcoma lesions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. ITGAV

Molecular Weight

19.7 kDa

References & Citations

Amino acid sequence of the vitronectin receptor alpha subunit and comparative expression of adhesion receptor mRNAs.Suzuki S., Argraves W.S., Arai H., Languino L.R., Pierschbacher M.D., Ruoslahti E.J. Biol. Chem. 262:14080-14085 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schistocerca americana Innexin inx1 (inx1)
orb2914768-01 20 µg

Recombinant Schistocerca americana Innexin inx1 (inx1)

Sign In for Pricing
View Details
Recombinant Schistocerca americana Innexin inx1 (inx1)
orb2914768-02 100 µg

Recombinant Schistocerca americana Innexin inx1 (inx1)

Sign In for Pricing
View Details
Human Sorting Nexin 19,SNX19 ELISA KIT
JOT-EK2547Hu-01 48 Well

Human Sorting Nexin 19,SNX19 ELISA KIT

Sign In for Pricing
View Details
Human Sorting Nexin 19,SNX19 ELISA KIT
JOT-EK2547Hu-02 96 Well

Human Sorting Nexin 19,SNX19 ELISA KIT

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Mitochondrial distribution and morphology protein 12 (MDM12)
MBS1328472-01 0.05 mg (E-Coli)

Recombinant Ashbya gossypii Mitochondrial distribution and morphology protein 12 (MDM12)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Mitochondrial distribution and morphology protein 12 (MDM12)
MBS1328472-02 0.05 mg (Yeast)

Recombinant Ashbya gossypii Mitochondrial distribution and morphology protein 12 (MDM12)

Sign In for Pricing
View Details