Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schistocerca americana Innexin inx1 (inx1)

This Recombinant Schistocerca americana Innexin inx1 (inx1) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Innexin inx1, Innexin-1, G-Inx1

UniProt

Q9XYN0

Expression Region

1-361

Origin

Schistocerca americana (American grasshopper)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYKLLGGLKEYLKWQDIVTDNAIFRLHNLFTTVLLLTCSLIITATQYVGNPIHCIVNGLP VRPINTYCWITSTFTMPDAFLRQVGSEVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQA MLCYTPKWIWDSIEGGLLRTLIMGLNRGLCQDDEKCMKKKALIEYLLRHIKRHNMYALKY WFCETLCLVNIIGQLYLMNHFFDGEFFSYGLRVVAFSEQSQEERVDPMVYVFPRVTKCTF HKYGASGSIQKHDSLCVLPLNIVNEKTYIFLWFWYIILAALLSVLVVYRAVILAVPSVRP ILLHARNRMVPKEVTNAICRKTDVGDWWILYMLGRNMDPMIYGEVIADLAKKIETPSSNN P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-100 1x 100 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details