Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Fibroblast growth factor 23 (Fgf23)

Product Specifications

Product Name Alternative

Fgf23Fibroblast growth factor 23; FGF-23

Abbreviation

Recombinant Rat Fgf23 protein

Gene Name

Fgf23

UniProt

Q8VI82

Expression Region

25-251aa

Organism

Rattus norvegicus (Rat)

Target Sequence

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Regulator of phosphate homeostasis . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels . Regulator of vitamin-D metabolism . Negatively regulates osteoblasts differentiation and matrix mineralization . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Regulator of phosphate homeostasis (By similarity) . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (By similarity) . Regulator of vitamin-D metabolism (By similarity) . Negatively regulates osteoblasts differentiation and matrix mineralization (By similarity) . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Molecular Weight

27.5 kDa

References & Citations

Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Amino-6-methoxy-2- (methylamino) pyridine dihydrochloride
OR8998 1 Each

3-Amino-6-methoxy-2- (methylamino) pyridine dihydrochloride

Sign In for Pricing
View Details
Human Matrilin 4 (MATN4) ELISA Kit
QY-E02132 96 Tests

Human Matrilin 4 (MATN4) ELISA Kit

Sign In for Pricing
View Details
OPG Antibody (Biotin)
GWB-2FF467 0.025 mg

OPG Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Rat Forkhead box protein D3 (Foxd3)
orb2658665-01 20 µg

Recombinant Rat Forkhead box protein D3 (Foxd3)

Sign In for Pricing
View Details
Recombinant Rat Forkhead box protein D3 (Foxd3)
orb2658665-02 100 µg

Recombinant Rat Forkhead box protein D3 (Foxd3)

Sign In for Pricing
View Details
Recombinant Rat Forkhead box protein D3 (Foxd3)
orb2658665-03 1 mg

Recombinant Rat Forkhead box protein D3 (Foxd3)

Sign In for Pricing
View Details