Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Forkhead box protein D3 (Foxd3)

This Recombinant Rat Forkhead box protein D3 (Foxd3) spans the amino acid sequence from region 1-101aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HNF3/FH transcription factor genesis; Hepatocyte nuclear factor 3 forkhead homolog 2; HFH-2

UniProt

Q63245

Expression Region

1-101aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal KIAA0146 Antibody
NBP2-58967 100 µL

Rabbit Polyclonal KIAA0146 Antibody

Sign In for Pricing
View Details
Guinea pig Cardiotrophin 1 ELISA Kit
MBS728216-01 48 Well

Guinea pig Cardiotrophin 1 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cardiotrophin 1 ELISA Kit
MBS728216-02 96 Well

Guinea pig Cardiotrophin 1 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cardiotrophin 1 ELISA Kit
MBS728216-03 5x 96 Well

Guinea pig Cardiotrophin 1 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cardiotrophin 1 ELISA Kit
MBS728216-04 10x 96 Well

Guinea pig Cardiotrophin 1 ELISA Kit

Sign In for Pricing
View Details
Aqr ORF Vector (Rat) (pORF)
ORF063555 1.0 µg DNA

Aqr ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details