Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DAN domain family member 5 (DAND5)

Product Specifications

Product Name Alternative

Cerberus-like protein 2 ; Cerl-2; Cysteine knot superfamily 1, BMP antagonist 3Gremlin-3

Abbreviation

Recombinant Human DAND5 protein

Gene Name

DAND5

UniProt

Q8N907

Expression Region

23-189aa

Organism

Homo sapiens (Human)

Target Sequence

RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Ses to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Seems to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation (By similarity) .

Molecular Weight

34.1 kDa

References & Citations

Identification and characterization of human CKTSF1B2 and CKTSF1B3 genes in silico.Katoh M., Katoh M.Oncol. Rep. 12:423-427 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AQP0 (Aquaporin 0, LIM1, MP26, MIP26, MIP) (FITC)
MBS6406952-01 0.1 mL

AQP0 (Aquaporin 0, LIM1, MP26, MIP26, MIP) (FITC)

Sign In for Pricing
View Details
AQP0 (Aquaporin 0, LIM1, MP26, MIP26, MIP) (FITC)
MBS6406952-02 5x 0.1 mL

AQP0 (Aquaporin 0, LIM1, MP26, MIP26, MIP) (FITC)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)
MBS1219219-01 0.02 mg (E-Coli)

Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)
MBS1219219-02 0.02 mg (Yeast)

Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)
MBS1219219-03 0.1 mg (E-Coli)

Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)
MBS1219219-04 0.1 mg (Yeast)

Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)

Sign In for Pricing
View Details