Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Purine nucleoside phosphorylase (PNP)

Product Specifications

Product Name Alternative

Inosine phosphorylaseInosine-guanosine phosphorylase

Abbreviation

Recombinant Human PNP protein

Gene Name

PNP

UniProt

P00491

Expression Region

1-289aa

Organism

Homo sapiens (Human)

Target Sequence

MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy) ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy) ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.

Molecular Weight

48.1 kDa

References & Citations

Human purine nucleoside phosphorylase cDNA sequence and genomic clone characterization.Williams S.R., Goddard J.M., Martin D.W. Jr.Nucleic Acids Res. 12:5779-5787 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1984 (CCDC183) (NM_001039374) Human Over-expression Lysate
LC422041 20 µg

KIAA1984 (CCDC183) (NM_001039374) Human Over-expression Lysate

Sign In for Pricing
View Details
GABRA6 Polyclonal Antibody
E-AB-90470-01 60 µL

GABRA6 Polyclonal Antibody

Sign In for Pricing
View Details
GABRA6 Polyclonal Antibody
E-AB-90470-02 120 µL

GABRA6 Polyclonal Antibody

Sign In for Pricing
View Details
GABRA6 Polyclonal Antibody
E-AB-90470-03 200 µL

GABRA6 Polyclonal Antibody

Sign In for Pricing
View Details
SP110 Mouse Monoclonal Antibody [Clone ID: OTI4C1]
CF807854 100 µg

SP110 Mouse Monoclonal Antibody [Clone ID: OTI4C1]

Sign In for Pricing
View Details
ZBTB7B antibody
FNab09598 100 µg

ZBTB7B antibody

Sign In for Pricing
View Details