Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3 (EIF4EBP3)
Product Specifications
Product Name Alternative
EIF4EBP3Eukaryotic translation initiation factor 4E-binding protein 3; 4E-BP3; eIF4E-binding protein 3
Abbreviation
Recombinant Human EIF4EBP3 protein
Gene Name
EIF4EBP3
UniProt
O60516
Expression Region
1-100aa
Organism
Homo sapiens (Human)
Target Sequence
MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Tag
N-terminal 6xHis-SUMO-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Epigenetics and Nuclear Signaling
Relevance
Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex
Molecular Weight
26.9 kDa
References & Citations
4E-BP3, a new member of the eukaryotic initiation factor 4E-binding protein family.Poulin F., Gingras A.-C., Olsen H., Chevalier S., Sonenberg N.J. Biol. Chem. 273:14002-14007 (1998)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-3614R-BF750-01 20 µL
PPAR alpha Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details bs-3614R-BF750-02 100 µL
PPAR alpha Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details MBS6378135-01 0.1 mL
FAP (Seprase, 170kD Melanoma Membrane-bound Gelatinase, Fibroblast Activation Protein alpha, Integral Membrane Serine Protease) (MaxLight 405)
Sign In for Pricing
View Details MBS6378135-02 5x 0.1 mL
FAP (Seprase, 170kD Melanoma Membrane-bound Gelatinase, Fibroblast Activation Protein alpha, Integral Membrane Serine Protease) (MaxLight 405)
Sign In for Pricing
View Details