Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein C-III (APOC3)

Product Specifications

Product Name Alternative

Apolipoprotein C3

Abbreviation

Recombinant Human APOC3 protein

Gene Name

APOC3

UniProt

P02656

Expression Region

21-99aa

Organism

Homo sapiens (Human)

Target Sequence

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma

Molecular Weight

24.8 kDa

References & Citations

Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes.Protter A.A., Levy-Wilson B., Miller J., Bencen G., White T., Seilhamer J.J.DNA 3:449-456 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IgD Monoclonal Antibody
AN301559L-01 50 µL

Recombinant Human IgD Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IgD Monoclonal Antibody
AN301559L-02 100 µL

Recombinant Human IgD Monoclonal Antibody

Sign In for Pricing
View Details
Ethylene-Beta-ionol-d3
TRC-E917542-10MG 10 mg

Ethylene-Beta-ionol-d3

Sign In for Pricing
View Details
CNPase Recombinant Rabbit Monoclonal Antibody [JF10-25]
ET1702-46 100 µL

CNPase Recombinant Rabbit Monoclonal Antibody [JF10-25]

Sign In for Pricing
View Details
Recombinant Mouse ACE2 Protein (His Tag)
PKSM040779-01 20 µg

Recombinant Mouse ACE2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse ACE2 Protein (His Tag)
PKSM040779-02 100 µg

Recombinant Mouse ACE2 Protein (His Tag)

Sign In for Pricing
View Details