Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA1/Serum Amyloid A-1, Mouse

Serum Amyloid A-1 Protein, a vital acute phase protein, primarily exists as a homohexamer composed of dimers of trimers.Although it can form amyloid fibrils after partial proteolysis, the native, undenatured form does not exhibit amyloid fibril formation in vitro.Serving as an apolipoprotein within the HDL complex, Serum Amyloid A-1 also shows affinity for heparin binding, highlighting its multifaceted role in biological processes.SAA1/Serum Amyloid A-1 Protein, Mouse is the recombinant mouse-derived Serum Amyloid A-1 protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

SAA1/Serum Amyloid A-1 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serum-amyloid-a-1-protein-mouse.html

Purity

97.00

Smiles

GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Molecular Formula

20208 (Gene_ID) P05366 (G20-Y122) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IKA ROTAVISC Quick Connector for Spindles
VIS2268 1 Each

IKA ROTAVISC Quick Connector for Spindles

Ask
View Details
Lentiviral human OR52E8 sgRNA gene knockout kit - Lentiviral human OR52E8 sgRNA gene knockout kit (25)
GTR15363342 1 Vial

Lentiviral human OR52E8 sgRNA gene knockout kit - Lentiviral human OR52E8 sgRNA gene knockout kit (25)

Ask
View Details
SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI3E9]
CF804221 100 µg

SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI3E9]

Ask
View Details
FLAP (ALOX5AP) (NM_001629) Human Tagged ORF Clone Lentiviral Particle
RC203785L2V 200 µL

FLAP (ALOX5AP) (NM_001629) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Chicken Vasohibin 1 (VASH1) ELISA Kit
MBS9344328 Inquire

Chicken Vasohibin 1 (VASH1) ELISA Kit

Ask
View Details
AcpS, Recombinant, Staphylococcus aureus, aa1-119, His-SUMO-Tag (Holo-[acyl-carrier-Protein] Synthase)
372129-01 20 µg

AcpS, Recombinant, Staphylococcus aureus, aa1-119, His-SUMO-Tag (Holo-[acyl-carrier-Protein] Synthase)

Ask
View Details