Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Category
Buffers and Solutions
CLIA Kit
Cytokines and Chemokines
Diagnostic Test Kits
ELISA Kit
Enzyme Products
Flow Cytometry Reagents
Peptide
Recombinant Protein
Secondary Antibodies
Western Blot Reagents
cDNA Clone
siRNA
Showing 50 of 197 products
ImageCatalog NumberProduct NameSizePriceAdd to Cart
HIV-2 Peptide4050175.05HIV-2 Peptide
0.5 mg
Sign In for Pricing
OEMA00052-1MG - HIV-2 gp36 seq PeptideOEMA00052-1MGOEMA00052-1MG - HIV-2 gp36 seq Peptide
1 mg
Sign In for Pricing
HIV-1 Tat Protein PeptideB1433-10HIV-1 Tat Protein Peptide
10 mg
Sign In for Pricing
Immunodeficiency virus (HIV-1) protease Peptide Proteinabx169013-01Immunodeficiency virus (HIV-1) protease Peptide Protein
10 µg
Sign In for Pricing
Immunodeficiency virus (HIV-1) protease Peptide Proteinabx169013-02Immunodeficiency virus (HIV-1) protease Peptide Protein
90 µg
Sign In for Pricing
Immunodeficiency virus (HIV-1) protease Peptide Proteinabx169013-03Immunodeficiency virus (HIV-1) protease Peptide Protein
1 mg
Sign In for Pricing
HIV gp120 Fragment Peptideabx266856-01HIV gp120 Fragment Peptide
1 mg
Sign In for Pricing
HIV gp120 Fragment Peptideabx266856-02HIV gp120 Fragment Peptide
5 mg
Sign In for Pricing
HIV gp120 Fragment Peptideabx266856-03HIV gp120 Fragment Peptide
10 mg
Sign In for Pricing
HIV gp120 Fragment Peptideabx266781-01HIV gp120 Fragment Peptide
1 mg
Sign In for Pricing
HIV gp120 Fragment Peptideabx266781-02HIV gp120 Fragment Peptide
5 mg
Sign In for Pricing
HIV gp120 Fragment Peptideabx266781-03HIV gp120 Fragment Peptide
10 mg
Sign In for Pricing
HIV-gp120-41-C Peptideabx266819-01HIV-gp120-41-C Peptide
1 mg
Sign In for Pricing
HIV-gp120-41-C Peptideabx266819-02HIV-gp120-41-C Peptide
5 mg
Sign In for Pricing
HIV-gp120-41-C Peptideabx266819-03HIV-gp120-41-C Peptide
10 mg
Sign In for Pricing
HIV gp120 PeptideMBS659996-01HIV gp120 Peptide
1 mg
Sign In for Pricing
HIV gp120 PeptideMBS659996-02HIV gp120 Peptide
5x 1 mg
Sign In for Pricing
HIV Peptide TMBS5819470HIV Peptide T
Inquire
Sign In for Pricing
HIV gag peptide (197-205)MBS5789348HIV gag peptide (197-205)
Inquire
Sign In for Pricing
HIV -gp120- Antigenic PeptideM41284HIV -gp120- Antigenic Peptide
1 Each
Sign In for Pricing
HIV-gp120-41-N-A PeptidePE-100304-01HIV-gp120-41-N-A Peptide
1 mg
Sign In for Pricing
HIV-gp120-41-N-A PeptidePE-100304-02HIV-gp120-41-N-A Peptide
5 mg
Sign In for Pricing
HIV-gp120-41-N-A PeptidePE-100304-03HIV-gp120-41-N-A Peptide
10 mg
Sign In for Pricing
HIV Integrase Protein Inhibitor (1) PeptidePE-52261-01HIV Integrase Protein Inhibitor (1) Peptide
1 mg
Sign In for Pricing
HIV Integrase Protein Inhibitor (1) PeptidePE-52261-02HIV Integrase Protein Inhibitor (1) Peptide
5 mg
Sign In for Pricing
HIV Integrase Protein Inhibitor (1) PeptidePE-52261-03HIV Integrase Protein Inhibitor (1) Peptide
10 mg
Sign In for Pricing
HIV-gp120-Fragment (254-274) PeptidePE-89133-01HIV-gp120-Fragment (254-274) Peptide
1 mg
Sign In for Pricing
HIV-gp120-Fragment (254-274) PeptidePE-89133-02HIV-gp120-Fragment (254-274) Peptide
5 mg
Sign In for Pricing
HIV-gp120-Fragment (254-274) PeptidePE-89133-03HIV-gp120-Fragment (254-274) Peptide
10 mg
Sign In for Pricing
HIV-1 TAT Protein (1-9) PeptidePE-89145-01HIV-1 TAT Protein (1-9) Peptide
1 mg
Sign In for Pricing
HIV-1 TAT Protein (1-9) PeptidePE-89145-02HIV-1 TAT Protein (1-9) Peptide
5 mg
Sign In for Pricing
HIV-1 TAT Protein (1-9) PeptidePE-89145-03HIV-1 TAT Protein (1-9) Peptide
10 mg
Sign In for Pricing
ZBTB7A (Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7, Factor Binding IST Protein 1, FBI1, FBI-1, Factor That Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, ZNF857A) (MaxLight 405) discontinued135518-ML405ZBTB7A (Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7, Factor Binding IST Protein 1, FBI1, FBI-1, Factor That Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, ZNF857A) (MaxLight 405) discontinued
100 µL
Sign In for Pricing
ZBTB7A (Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7, Factor Binding IST Protein 1, FBI1, FBI-1, Factor That Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, ZNF857A) (MaxLight 750) discontinued135518-ML750ZBTB7A (Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7, Factor Binding IST Protein 1, FBI1, FBI-1, Factor That Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, ZNF857A) (MaxLight 750) discontinued
100 µL
Sign In for Pricing
HIV-1 gp120 Control Peptide (Human Immunodeficiency Virus Type 1)H6003-01HHIV-1 gp120 Control Peptide (Human Immunodeficiency Virus Type 1)
50 µg
Sign In for Pricing
Pokemon (POK Erythroid Myeloid Ontogenic Factor, Factor that Binds to Inducer of Short Transcripts Protein 1, Factor Binding IST Protein 1, FBI1, FBI-1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, TTF-I Interacting Peptide 21, TIP21, Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7A, ZBTB7) (Not for Export EU)P4398-50FPokemon (POK Erythroid Myeloid Ontogenic Factor, Factor that Binds to Inducer of Short Transcripts Protein 1, Factor Binding IST Protein 1, FBI1, FBI-1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, TTF-I Interacting Peptide 21, TIP21, Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7A, ZBTB7) (Not for Export EU)
100 µL
Sign In for Pricing
ZBTB7A, CT (Zinc Finger and BTB Domain-containing Protein 7A, Factor Binding IST Protein 1, FBI-1, Factor that Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/Lymphoma-related Factor, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, FBI1, LRF, ZBTB7, ZNF857A) discontinuedZ0737-66ZBTB7A, CT (Zinc Finger and BTB Domain-containing Protein 7A, Factor Binding IST Protein 1, FBI-1, Factor that Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/Lymphoma-related Factor, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, FBI1, LRF, ZBTB7, ZNF857A) discontinued
50 µg
Sign In for Pricing
HIV-1 gp41 Antigenic Peptide 1 (GCSGKLICTTAVPWNAS)H6000-05YHIV-1 gp41 Antigenic Peptide 1 (GCSGKLICTTAVPWNAS)
1 mg
Sign In for Pricing
HIV-2 gp41 Antigenic Peptide 5 (RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2)H6000-05ZHIV-2 gp41 Antigenic Peptide 5 (RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2)
1 mg
Sign In for Pricing
HIV RT (pol) A2.1 peptideCCP1267-01HIV RT (pol) A2.1 peptide
1 mg
Sign In for Pricing
HIV RT (pol) A2.1 peptideCCP1267-02HIV RT (pol) A2.1 peptide
5 mg
Sign In for Pricing
HIV RT (pol) A2.1 peptideCCP1267-03HIV RT (pol) A2.1 peptide
10 mg
Sign In for Pricing
HIV-gp41-Antigenic Peptide 5CCP2471-01HIV-gp41-Antigenic Peptide 5
1 mg
Sign In for Pricing
HIV-gp41-Antigenic Peptide 5CCP2471-02HIV-gp41-Antigenic Peptide 5
5 mg
Sign In for Pricing
HIV-gp41-Antigenic Peptide 5CCP2471-03HIV-gp41-Antigenic Peptide 5
10 mg
Sign In for Pricing
HIV RT (pol) A2.1 peptideGTR18897152-01HIV RT (pol) A2.1 peptide
1 mg
Sign In for Pricing
HIV RT (pol) A2.1 peptideGTR18897152-02HIV RT (pol) A2.1 peptide
5 mg
Sign In for Pricing
HIV RT (pol) A2.1 peptideGTR18897152-03HIV RT (pol) A2.1 peptide
10 mg
Sign In for Pricing
HIV gp41 Antibody Blocking PeptideGTR19035704HIV gp41 Antibody Blocking Peptide
500 µg
Sign In for Pricing
HIV gag peptide (197-205)GTR19036928-01HIV gag peptide (197-205)
100 mg
Sign In for Pricing
1 2 3 4