Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Flotillin-2 (FLOT2)

Product Specifications

Product Name Alternative

Epidermal surface antigen; ESA; Membrane component chromosome 17 surface marker 1

Abbreviation

Recombinant Human FLOT2 protein

Gene Name

FLOT2

UniProt

Q14254

Expression Region

2-428aa

Organism

Homo sapiens (Human)

Target Sequence

GNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. May be involved in epidermal cell adhesion and epidermal structure and function.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C130026I21Rik shRNA Plasmid (m)
sc-141823-SH 20 µg

C130026I21Rik shRNA Plasmid (m)

Sign In for Pricing
View Details
HSPA1A siRNA (Rat)
MBS8215599-01 15 nmol

HSPA1A siRNA (Rat)

Sign In for Pricing
View Details
HSPA1A siRNA (Rat)
MBS8215599-02 30 nmol

HSPA1A siRNA (Rat)

Sign In for Pricing
View Details
HSPA1A siRNA (Rat)
MBS8215599-03 5x 30 nmol

HSPA1A siRNA (Rat)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit
RD-TNFSF13-Mu-01 96 Tests

Mouse Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit
RD-TNFSF13-Mu-02 48 Tests

Mouse Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit

Sign In for Pricing
View Details