Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rabbit

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Rabbit consists of 152 amino acids (A117-S268) and is expressed in E. coli.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rabbit, Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-rabbit.html

Purity

98.00

Smiles

AVRSLHCRLQDAQQKSLVLSGTYELKALHLNAENLNQQVVFSMSFVQGEESNDKIPVALGLRGKNLYLSCVMKDDKPTLQLESVDPNRYPKKKMEKRFVFNKIEIKDKLEFESAQFPNWYISTSQTEYMPVFLGNNSGGQDLIDFSMEFVSS

Molecular Formula

100008990 (Gene_ID) P14628 (A117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD8 Antibody (C8/1779R) [Dylight 594]
NBP2-54595DL594 0.1 mL

Rabbit Monoclonal CD8 Antibody (C8/1779R) [Dylight 594]

Sign In for Pricing
View Details
Human MC4R‚Â ELISA‚Â Kit (Ready to Use)
orb692757-01 48 Tests

Human MC4R‚Â ELISA‚Â Kit (Ready to Use)

Sign In for Pricing
View Details
Human MC4R‚Â ELISA‚Â Kit (Ready to Use)
orb692757-02 96 Tests

Human MC4R‚Â ELISA‚Â Kit (Ready to Use)

Sign In for Pricing
View Details
MTRNR2L6 (NM_001190487) Human Tagged ORF Clone
RC230906 10 µg

MTRNR2L6 (NM_001190487) Human Tagged ORF Clone

Sign In for Pricing
View Details
Gdf9 (NM_021672) Rat Untagged Clone
RN205293 10 µg

Gdf9 (NM_021672) Rat Untagged Clone

Sign In for Pricing
View Details
Plk2 Mouse shRNA Lentiviral Particle (Locus ID 20620)
TL502091V 500 µL Each

Plk2 Mouse shRNA Lentiviral Particle (Locus ID 20620)

Sign In for Pricing
View Details