Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INHBE, Human (HEK293, Fc)

The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth. INHBE Protein, Human (HEK293, Fc) is the recombinant human-derived INHBE protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

INHBE Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/inhbe-protein-human-hek293-fc.html

Purity

98.0

Smiles

TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Molecular Formula

83729 (Gene_ID) P58166 (T237-S350) (Accession)

Molecular Weight

Approximately 43 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P73 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV777813 1.0 µg DNA

RPL21P73 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Anti-Endothelin 1 Rabbit pAb
GB115574-100 100 μL

Anti-Endothelin 1 Rabbit pAb

Sign In for Pricing
View Details
ZMPSTE24 Rabbit pAb
E45R29872N-50 50 µL

ZMPSTE24 Rabbit pAb

Sign In for Pricing
View Details
LGR5 Rabbit Polyclonal Antibody
orb628431-01 50 µg

LGR5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LGR5 Rabbit Polyclonal Antibody
orb628431-02 100 µg

LGR5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PNZ5 5mg
A12764-5 5 mg

PNZ5 5mg

Sign In for Pricing
View Details