Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-7, Human (HEK293, His)

IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-7-protein-human-hek-293-his.html

Purity

98.0

Smiles

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Molecular Formula

3490 (Gene_ID) Q16270-1 (S27-L282) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MAP1 Antibody [Alexa Fluor 488]
NBP2-97771AF488 0.1 mL

Rabbit Polyclonal MAP1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
PCSK6 Antibody, FITC conjugated
A30807-50UG 50 µg

PCSK6 Antibody, FITC conjugated

Sign In for Pricing
View Details
3-Bromo-2-fluorobenzoic acid
FB38271-01 0.01 kg

3-Bromo-2-fluorobenzoic acid

Sign In for Pricing
View Details
3-Bromo-2-fluorobenzoic acid
FB38271-02 0.025 kg

3-Bromo-2-fluorobenzoic acid

Sign In for Pricing
View Details
3-Bromo-2-fluorobenzoic acid
FB38271-03 0.05 kg

3-Bromo-2-fluorobenzoic acid

Sign In for Pricing
View Details
3-Bromo-2-fluorobenzoic acid
FB38271-04 0.1 Kg

3-Bromo-2-fluorobenzoic acid

Sign In for Pricing
View Details