Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cornifin-A (Sprr1a)

Product Specifications

Product Name Alternative

Small proline-rich protein 1A; SPR1 A; SPR1A

Abbreviation

Recombinant Mouse Sprr1a protein

Gene Name

Sprr1a

UniProt

Q62266

Expression Region

1-144aa

Organism

Mus musculus (Mouse)

Target Sequence

MSSHQQKQPCTVPPQLHQQQVKQPCQPPPQEPCAPKTKDPCHPVPEPCNPKGPEPCHPKAPEPCHPKAPEPCNPKVPEPCQPKVPEPCQPKVPEPCNPKVPEPCQPKAPEPCHPKAPEPCHPVVPEPCPSTVTPSPYQQKTKQK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. May participate widely in the construction of cell envelopes in cornifying epithelia characterized by either increased thickness or a requirement for extreme flexibility.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a28 Mouse shRNA Plasmid (Locus ID 434674)
TL508832 1 Kit

Slc22a28 Mouse shRNA Plasmid (Locus ID 434674)

Sign In for Pricing
View Details
RB1 Peptide - middle region (AAP58066)
AAP58066-100UG 100 µg

RB1 Peptide - middle region (AAP58066)

Sign In for Pricing
View Details
D19Wsu162e ORF Vector (Mouse) (pORF)
ORF042523 1.0 µg DNA

D19Wsu162e ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal CADPS Antibody [Alexa Fluor 350]
NBP1-77323AF350 0.1 mL

Rabbit Polyclonal CADPS Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
PDE2A Antibody - middle region
MBS3221611-01 0.1 mL

PDE2A Antibody - middle region

Sign In for Pricing
View Details
PDE2A Antibody - middle region
MBS3221611-02 5x 0.1 mL

PDE2A Antibody - middle region

Sign In for Pricing
View Details