Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sialidase-4 (Neu4)

Product Specifications

Product Name Alternative

N-acetyl-alpha-neuraminidase 4 (Neuraminidase 4)

Abbreviation

Recombinant Mouse Neu4 protein

Gene Name

Neu4

UniProt

Q8BZL1

Expression Region

1-478aa

Organism

Mus musculus (Mouse)

Target Sequence

MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEPQDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDGDKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQGHCWPS

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

May function in lysosomal catabolism of sialylated glycoconjugates. Has sialidase activity towards synthetic substrates, such as 2'--alpha-D-N-acetylneuraminic acid . Has a broad substrate specificity being active on glycoproteins, oligosaccharides and sialylated glycolipids .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.5 kDa

References & Citations

"Identification and expression of Neu4, a novel murine sialidase." Comelli E.M., Amado M., Lustig S.R., Paulson J.C. Gene 321:155-161 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actrt2 Mouse Gene Knockout Kit (CRISPR)
KN500798 1 Kit

Actrt2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB527435 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
Human Ephrin A4 (EFNA4) ELISA Kit
RDR-EFNA4-Hu-01 96 Tests

Human Ephrin A4 (EFNA4) ELISA Kit

Sign In for Pricing
View Details
Human Ephrin A4 (EFNA4) ELISA Kit
RDR-EFNA4-Hu-02 48 Tests

Human Ephrin A4 (EFNA4) ELISA Kit

Sign In for Pricing
View Details
Cleveland Open Cup Flash Point Tester BPTL-232
BPTL-232 1 Unit

Cleveland Open Cup Flash Point Tester BPTL-232

Sign In for Pricing
View Details
Mini Sample Human CASP3 (Caspase 3) ELISA Kit
E-MSEL-H0021-01 24 Tests

Mini Sample Human CASP3 (Caspase 3) ELISA Kit

Sign In for Pricing
View Details