Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, intestinal (FABP2)

Product Specifications

Product Name Alternative

Fatty acid-binding protein 2; Intestinal-type fatty acid-binding protein; I-FABP

Abbreviation

Recombinant Human FABP2 protein

Gene Name

FABP2

UniProt

P12104

Expression Region

2-132aa

Organism

Homo sapiens (Human)

Target Sequence

AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloropropanoic acid
TRC-C381040-5G 5 g

2-Chloropropanoic acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS800894 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF647 conjugate, 0.1mg/mL
BNC471670-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Iberin
TRC-I124900-5MG 5 mg

Iberin

Sign In for Pricing
View Details
KCNJ11 Rabbit Polyclonal Antibody
AP01225PU-N 100 µg

KCNJ11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rchy1 Mouse Gene Knockout Kit (CRISPR)
KN514612 1 Kit

Rchy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details