Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product Specifications

Product Name Alternative

Pre-GP-C (GP-C)

Abbreviation

Recombinant Lassa virus GPC protein, partial

Gene Name

GPC

UniProt

P17332

Expression Region

59-258aa

Organism

Lassa virus (strain GA391) (LASV)

Target Sequence

LIYKGTYELQTLELNMETLNMTMPLSCTKNNSHHYIRVGNETGLELTLTNTSILNHKFCNLSDAHKRNLYDHSLMSIISTFHLSIPNFNQYEAMSCDFNGGKITVQYNLSHSFAVDAAGHCGTLANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWDDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Signal Transduction

Relevance

Glycoprotein G2: class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.6 kDa

References & Citations

"Nucleotide sequence of the S RNA of Lassa virus (Nigerian strain) and comparative analysis of arenavirus gene products." Clegg J.C.S., Wilson S.M., Oram J.D. Virus Res. 18:151-164 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR177 Rabbit Polyclonal Antibody (PE-Cy5)
orb914327 100 µL

GPR177 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
PRCD Rabbit Polyclonal Antibody
orb3070745-01 30 µL

PRCD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRCD Rabbit Polyclonal Antibody
orb3070745-02 50 µL

PRCD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRCD Rabbit Polyclonal Antibody
orb3070745-03 100 µL

PRCD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRCD Rabbit Polyclonal Antibody
orb3070745-04 200 µL

PRCD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human NDFIP2 shRNA (UAS) - Lentiviral human NDFIP2 shRNA (UAS, GFP) (25)
GTR15124172 1 Vial

Lentiviral human NDFIP2 shRNA (UAS) - Lentiviral human NDFIP2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details