TFF2, Mouse (HEK293, His)
TFF2 Protein inhibits gastrointestinal motility and gastric acid secretion.It is proposed to act as a structural component of gastric mucus, potentially stabilizing glycoproteins within the mucus gel through interactions with carbohydrate side chains.This helps maintain the integrity of the gastric mucosal barrier.TFF2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TFF2 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tff2-protein-mouse-hek-293-his.html
Purity
95.0
Smiles
EKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFDSSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFFPQSVEDCHY
Molecular Formula
21785 (Gene_ID) Q03404 (E24-Y129) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Monoclonal Complexin-2 Antibody (021) [Alexa Fluor 647]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Rabbit Monoclonal Complexin-2 Antibody (021) [Alexa Fluor 647]
Human Collagen triple helix repeat containing 1 (CTHRC1) ELISA Kit
Human Collagen triple helix repeat containing 1 (CTHRC1) ELISA Kit
Human Collagen triple helix repeat containing 1 (CTHRC1) ELISA Kit