Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSF, Human (His)

CTSF Protein, a thiol protease, participates in intracellular protein degradation and turnover. Its association with tumor invasion and metastasis suggests potential involvement in critical cellular processes related to cancer progression. CTSF Protein, Human (His) is the recombinant human-derived CTSF protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CTSF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctsf-protein-human-his.html

Purity

93

Smiles

PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD

Molecular Formula

8722 (Gene_ID) Q9UBX1 (P273-D484) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF488A conjugate, 0.1mg/mL
BNC881210-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Mouse CD64/FcγRI Antibody[X54-5/7.1]
E-AB-F1186UE-01 25 µg

APC Anti-Mouse CD64/FcγRI Antibody[X54-5/7.1]

Sign In for Pricing
View Details
APC Anti-Mouse CD64/FcγRI Antibody[X54-5/7.1]
E-AB-F1186UE-02 100 µg

APC Anti-Mouse CD64/FcγRI Antibody[X54-5/7.1]

Sign In for Pricing
View Details
4-Fluoroanisole
TRC-F587680-1G 1 g

4-Fluoroanisole

Sign In for Pricing
View Details
5 HT1F (HTR1F) Human Gene Knockout Kit (CRISPR)
KN420624 1 Kit

5 HT1F (HTR1F) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Trichlorfon (>90%)
TRC-T773855-5G 5 g

Trichlorfon (>90%)

Sign In for Pricing
View Details