CTSF, Human (His)
CTSF Protein, a thiol protease, participates in intracellular protein degradation and turnover. Its association with tumor invasion and metastasis suggests potential involvement in critical cellular processes related to cancer progression. CTSF Protein, Human (His) is the recombinant human-derived CTSF protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
CTSF Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctsf-protein-human-his.html
Purity
93
Smiles
PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD
Molecular Formula
8722 (Gene_ID) Q9UBX1 (P273-D484) (Accession)
Molecular Weight
Approximately 32 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1129205-01 0.02 mg (E-Coli)
Recombinant Oscillatoria agardhii Lectin OAA
Sign In for Pricing
View Details MBS1129205-02 0.1 mg (E-Coli)
Recombinant Oscillatoria agardhii Lectin OAA
Sign In for Pricing
View Details MBS1129205-03 0.02 mg (Yeast)
Recombinant Oscillatoria agardhii Lectin OAA
Sign In for Pricing
View Details