Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT-4, Mouse

NT-4 Protein, Mouse is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR) .

Product Specifications

Product Name Alternative

NT-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nt-4-protein-mouse.html

Purity

95.0

Smiles

MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA

Molecular Formula

78405 (Gene_ID) Q80VU4 (G80-A209) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]D'Angelo L, et al. Neurotrophin-4 in the brain of adult Nothobranchius furzeri. Ann Anat. 2016 Sep;207:47-54.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FABP6/I-BABP Protein
PKSH030811 100 µg

Recombinant Human FABP6/I-BABP Protein

Sign In for Pricing
View Details
LEC (CCL16) Human Gene Knockout Kit (CRISPR)
KN424009 1 Kit

LEC (CCL16) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CYB5RL (NM_001031672) Human Over-expression Lysate
LC422220 20 µg

CYB5RL (NM_001031672) Human Over-expression Lysate

Sign In for Pricing
View Details
Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF740 conjugate, 0.1mg/mL
BNC743732-500 1x 500 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS801179 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
USP39 antibody
FNab09332 100 µg

USP39 antibody

Sign In for Pricing
View Details