Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT-4, Mouse

NT-4 Protein, Mouse is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR) .

Product Specifications

Product Name Alternative

NT-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nt-4-protein-mouse.html

Purity

95.0

Smiles

MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA

Molecular Formula

78405 (Gene_ID) Q80VU4 (G80-A209) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]D'Angelo L, et al. Neurotrophin-4 in the brain of adult Nothobranchius furzeri. Ann Anat. 2016 Sep;207:47-54.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Rpb1 CTD (Ser7) Rabbit mAb
F1261-100uL 100 µL

Phospho-Rpb1 CTD (Ser7) Rabbit mAb

Sign In for Pricing
View Details
OTUB2 ORF Vector (Human) (pORF)
ORF007430 1.0 µg DNA

OTUB2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Malectin/MLEC Rabbit Polyclonal Antibody (Fluoro488)
orb3096291 100 µg

Malectin/MLEC Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
14,15-epoxy-5 (Z),8 (Z),11 (Z),17 (Z) -eicosatetraenoic acid
MBS394113-01 0.1 mg

14,15-epoxy-5 (Z),8 (Z),11 (Z),17 (Z) -eicosatetraenoic acid

Sign In for Pricing
View Details
14,15-epoxy-5 (Z),8 (Z),11 (Z),17 (Z) -eicosatetraenoic acid
MBS394113-02 5x 0.1 mg

14,15-epoxy-5 (Z),8 (Z),11 (Z),17 (Z) -eicosatetraenoic acid

Sign In for Pricing
View Details
Recombinant Tityus costatus Scorpine-like peptide Tco 41.46-2
MBS1439298-01 0.02 mg (E-Coli)

Recombinant Tityus costatus Scorpine-like peptide Tco 41.46-2

Sign In for Pricing
View Details