Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT-4, Mouse

NT-4 Protein, Mouse is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR) .

Product Specifications

Product Name Alternative

NT-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nt-4-protein-mouse.html

Purity

95.0

Smiles

MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA

Molecular Formula

78405 (Gene_ID) Q80VU4 (G80-A209) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]D'Angelo L, et al. Neurotrophin-4 in the brain of adult Nothobranchius furzeri. Ann Anat. 2016 Sep;207:47-54.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin Vc Double Nickase Plasmid (h2)
sc-407971-NIC-2 20 µg

Myosin Vc Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Nori® Goose CCL4 ELISA Kit
GR173054 96 Well

Nori® Goose CCL4 ELISA Kit

Sign In for Pricing
View Details
EB2 (MAPRE2) (NM_014268) Human Recombinant Protein
E45H42145M5 20 µg

EB2 (MAPRE2) (NM_014268) Human Recombinant Protein

Sign In for Pricing
View Details
Human G Protein Coupled Receptor 120 ELISA Kit
MBS763181-01 48 Well

Human G Protein Coupled Receptor 120 ELISA Kit

Sign In for Pricing
View Details
Human G Protein Coupled Receptor 120 ELISA Kit
MBS763181-02 96 Well

Human G Protein Coupled Receptor 120 ELISA Kit

Sign In for Pricing
View Details
Human G Protein Coupled Receptor 120 ELISA Kit
MBS763181-03 5x 96 Well

Human G Protein Coupled Receptor 120 ELISA Kit

Sign In for Pricing
View Details