Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein-10 (KLK10), partial

Product Specifications

Product Name Alternative

Normal epithelial cell-specific 1; Protease serine-like 1

Abbreviation

Recombinant Human KLK10 protein, partial

Gene Name

KLK10

UniProt

O43240

Expression Region

31-274aa

Organism

Homo sapiens (Human)

Target Sequence

AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Cycle

Relevance

Has a tumor-suppressor role for NES1 in breast and prostate cancer.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has a tumor-suppressor role for NES1 in breast and prostate cancer.

Molecular Weight

30.8 kDa

References & Citations

The role for NES1 serine protease as a novel tumor suppressor.Goyal J., Smith K.M., Cowan J.M., Wazer D.E., Lee S.W., Band V.Cancer Res. 58:4782-4786 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details