Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR, Human (HEK293, His)

GIPR protein, a receptor for glucose-dependent insulinotropic polypeptide (GIP), operates through G proteins that activate adenylyl cyclase. Its capacity for homodimer and heterodimer formation with GLP1R implies potential interactions between receptors linked to incretin hormones. GIPR Protein, Human (HEK293, His) is the recombinant human-derived GIPR, expressed by HEK293, with C-10*His labeled tag. The total length of GIPR Protein, Human (HEK293, His) is 117 a.a..

Product Specifications

Product Name Alternative

GIPR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gipr-protein-human-hek293-his.html

Purity

97.00

Smiles

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Molecular Formula

2696 (Gene_ID) P48546-1 (R22-Q138) (Accession)

Molecular Weight

Approximately 22-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-500 1x 500 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-100 1x 100 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106 + TMS715), CF640R conjugate, 0.1mg/mL
BNC400716-500 1x 500 µL

Thymidylate Synthase (TS106 + TMS715), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF594 conjugate, 0.1mg/mL
BNC942332-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details