Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR, Human (HEK293, His)

GIPR protein, a receptor for glucose-dependent insulinotropic polypeptide (GIP), operates through G proteins that activate adenylyl cyclase. Its capacity for homodimer and heterodimer formation with GLP1R implies potential interactions between receptors linked to incretin hormones. GIPR Protein, Human (HEK293, His) is the recombinant human-derived GIPR, expressed by HEK293, with C-10*His labeled tag. The total length of GIPR Protein, Human (HEK293, His) is 117 a.a..

Product Specifications

Product Name Alternative

GIPR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gipr-protein-human-hek293-his.html

Purity

97.00

Smiles

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Molecular Formula

2696 (Gene_ID) P48546-1 (R22-Q138) (Accession)

Molecular Weight

Approximately 22-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Leucine Aminopepridase ELISA Kit
MBS010926 Inquire

Rabbit Leucine Aminopepridase ELISA Kit

Sign In for Pricing
View Details
TrxR1 Lentiviral Activation Particles (h2)
sc-400994-LAC-2 200 µL

TrxR1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Meiob (NM_029197) Mouse Tagged Lenti ORF Clone
MR213695L4 10 µg

Meiob (NM_029197) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C17orf28 ORF Vector (Human) (pORF)
13967011 1.0 µg DNA

C17orf28 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ERCC6 Protein Vector (Human) (pPM-C-HA)
PV051735 500 ng

ERCC6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human Pygopus homolog 1 (PYGO1) ELISA Kit
abx540910 96 Tests

Human Pygopus homolog 1 (PYGO1) ELISA Kit

Sign In for Pricing
View Details