Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 5 (Fgf5)

Product Specifications

Product Name Alternative

(FGF-5) (Heparin-binding growth factor 5) (HBGF-5)

Abbreviation

Recombinant Mouse Fgf5 protein

Gene Name

Fgf5

UniProt

P15656

Expression Region

21-264aa

Organism

Mus musculus (Mouse)

Target Sequence

HGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVKPKVPLSQPRRSPSPVKYRLKFRFG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.3 kDa

References & Citations

"Functions of fibroblast growth factor (FGF) -2 and FGF-5 in astroglial differentiation and blood-brain barrier permeability: evidence from mouse mutants." Reuss B., Dono R., Unsicker K. J Neurosci 23:6404-6412 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor hsa-miR-548ao-3p AAV miRNA Vector
Amh3191700 500 ng

Inhibitor hsa-miR-548ao-3p AAV miRNA Vector

Sign In for Pricing
View Details
Cdh17 (NM_053977) Rat Tagged ORF Clone Lentiviral Particle
RR206096L4V 200 µL

Cdh17 (NM_053977) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PHB2 Adenovirus (Mouse)
36531054 1.0 mL

PHB2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Rat Olfactory receptor 5P3 (OR5P3) ELISA Kit
GTR10341432 96 Well

Rat Olfactory receptor 5P3 (OR5P3) ELISA Kit

Sign In for Pricing
View Details
BRD1 Antibody Blocking peptide
orb1445499 500 µg

BRD1 Antibody Blocking peptide

Sign In for Pricing
View Details
SYT2
336372-01 50 µL

SYT2

Sign In for Pricing
View Details