Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (C-His)

15-PGDH/HPGD, a short-chain nonmetalloenzyme alcohol dehydrogenase, is crucial for prostaglandin metabolism, influencing various physiological and cellular processes like inflammation. Mutations lead to hypertrophic osteoarthropathy. Biased expression in urinary bladder (RPKM 176.8) and stomach (RPKM 67.9), among other tissues. Multiple isoforms arise from various transcript variants. 15-PGDH/HPGD Protein, Human (C-His) is the recombinant human-derived 15-PGDH/HPGD, expressed by E. coli, with C-6*His labeled tag. The total length of 15-PGDH/HPGD Protein, Human (C-His) is 266 a.a..

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-c-his.html

Purity

98.00

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) NP_000851.2 (M1-Q266) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Artery: peripheral
CS627114 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
Phensuximide
TRC-P318900-50MG 50 mg

Phensuximide

Sign In for Pricing
View Details
CD27 Antibody
KC-2454-01 50 μL

CD27 Antibody

Sign In for Pricing
View Details
CD27 Antibody
KC-2454-02 100 µL

CD27 Antibody

Sign In for Pricing
View Details
CD27 Antibody
KC-2454-03 1 mL

CD27 Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Prostate
CP565691 150 µg

Tissue Protein Lysate, Prostate

Sign In for Pricing
View Details