Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (C-His)

15-PGDH/HPGD, a short-chain nonmetalloenzyme alcohol dehydrogenase, is crucial for prostaglandin metabolism, influencing various physiological and cellular processes like inflammation. Mutations lead to hypertrophic osteoarthropathy. Biased expression in urinary bladder (RPKM 176.8) and stomach (RPKM 67.9), among other tissues. Multiple isoforms arise from various transcript variants. 15-PGDH/HPGD Protein, Human (C-His) is the recombinant human-derived 15-PGDH/HPGD, expressed by E. coli, with C-6*His labeled tag. The total length of 15-PGDH/HPGD Protein, Human (C-His) is 266 a.a..

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-c-his.html

Purity

98.00

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) NP_000851.2 (M1-Q266) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STCH (HSPA13) (NM_006948) Human Over-expression Lysate
LY402066 100 µg

STCH (HSPA13) (NM_006948) Human Over-expression Lysate

Sign In for Pricing
View Details
MDA5 (IFIH1) (NM_022168) Human Recombinant Protein
TP315661M 100 µg

MDA5 (IFIH1) (NM_022168) Human Recombinant Protein

Sign In for Pricing
View Details
PRPF18 Antibody
8C17852-AAT 50 µg

PRPF18 Antibody

Sign In for Pricing
View Details
PI 4 Kinase type 2 beta (PI4K2B) (N-term) Rabbit Polyclonal Antibody
AP14957PU-N 400 µL

PI 4 Kinase type 2 beta (PI4K2B) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ibogaine Hydrochloride
TRC-I123000-5MG 5 mg

Ibogaine Hydrochloride

Sign In for Pricing
View Details
MFluor™ Violet 450 Anti-human CD56 Antibody *My31*
105620Z0-AAT 100 Tests

MFluor™ Violet 450 Anti-human CD56 Antibody *My31*

Sign In for Pricing
View Details