B7-H4, Mouse (HEK293, Fc)
B7-H4 Protein, Mouse (HEK293, Fc) may participate in negative regulation of cell-mediated immunity in peripheral tissues. Cell-associated B7-H4 could also inhibit T cell response. B7-H4 acts as a morphogenic factor for cancer cells[1][2][3].
Product Specifications
Product Name Alternative
B7-H4 Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-h4-protein-mouse-hek293-fc.html
Purity
97.68
Smiles
FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRSSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSGP
Molecular Formula
242122 (Gene_ID) Q7TSP5/AAH32925.1 (F29-P258) (Accession)
Molecular Weight
70-90 kDa
References & Citations
[1]Gabriel L Sica, et al. B7-H4, a molecule of the B7 family, negatively regulates T cell immunity. Immunity. 2003 Jun;18 (6) :849-61.|[2]Joseph R Podojil, et al. Potential targeting of B7-H4 for the treatment of cancer. Immunol Rev. 2017 Mar;276 (1) :40-51.|[3]Yun Qian, et al. B7-H4 enhances oncogenicity and inhibits apoptosis in pancreatic cancer cells. Cell Tissue Res. 2013 Jul;353 (1) :139-51.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 