Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein A (His)

Protein A protein (His) is the recombinant Staphylococcus aureus-derived Protein A, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IgG-binding A protein (His), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-a-protein-his.html

Purity

97.00

Smiles

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEED

Molecular Formula

3919448 (Gene_ID) P02976 (N35-D330) (Accession)

Molecular Weight

Approximately 32-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Recombinant UCHL5
6359-100 100 µg

Human Recombinant UCHL5

Sign In for Pricing
View Details
KRT223P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
26009111 3x 1.0 µg

KRT223P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TRAPPC6B (NM_001079537) Human Tagged Lenti ORF Clone
RC221864L3 10 µg

TRAPPC6B (NM_001079537) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Methyl 3-Bromo-4-fluoro-5-nitrobenzoate
455172-01 100 mg

Methyl 3-Bromo-4-fluoro-5-nitrobenzoate

Sign In for Pricing
View Details
Methyl 3-Bromo-4-fluoro-5-nitrobenzoate
455172-02 250 mg

Methyl 3-Bromo-4-fluoro-5-nitrobenzoate

Sign In for Pricing
View Details
Zelminemab (Anti-PAC1)
A2385-1mg*25 25x 1 mg

Zelminemab (Anti-PAC1)

Sign In for Pricing
View Details