Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein A (His)

Protein A protein (His) is the recombinant Staphylococcus aureus-derived Protein A, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IgG-binding A protein (His), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-a-protein-his.html

Purity

97.00

Smiles

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEED

Molecular Formula

3919448 (Gene_ID) P02976 (N35-D330) (Accession)

Molecular Weight

Approximately 32-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAGEA9 Pre-designed siRNA Set B
SI009112B 1 Each

Human MAGEA9 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal anti-human VEGFR2
hAP-0002A 50 µg

Mouse Monoclonal anti-human VEGFR2

Sign In for Pricing
View Details
Emx1 (G-6) : m-IgGκ BP-HRP Bundle
sc-524221 1 Kit

Emx1 (G-6) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Human FKSG14 (CENPK) (NM_001267038) AAV Particle
RC233599A1V 250 µL

Human FKSG14 (CENPK) (NM_001267038) AAV Particle

Sign In for Pricing
View Details
Human RAB6A siRNA
abx904433-01 15 nmol

Human RAB6A siRNA

Sign In for Pricing
View Details
Human RAB6A siRNA
abx904433-02 30 nmol

Human RAB6A siRNA

Sign In for Pricing
View Details