Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein A (His)

Protein A protein (His) is the recombinant Staphylococcus aureus-derived Protein A, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IgG-binding A protein (His), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-a-protein-his.html

Purity

97.00

Smiles

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEED

Molecular Formula

3919448 (Gene_ID) P02976 (N35-D330) (Accession)

Molecular Weight

Approximately 32-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBS Buffer
9004500 500 mL

PBS Buffer

Sign In for Pricing
View Details
Rabbit Polyclonal ZBTB8A Antibody [Janelia Fluor 646]
NBP1-76521JF646 0.1 mL

Rabbit Polyclonal ZBTB8A Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Convallatoxin 90%
C25240-01 10 mg

Convallatoxin 90%

Sign In for Pricing
View Details
Convallatoxin 90%
C25240-02 25 mg

Convallatoxin 90%

Sign In for Pricing
View Details
HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845) (APC)
247215-APC 100 µL

HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845) (APC)

Sign In for Pricing
View Details
Histone H4 (tri methyl K20) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2393308 100 µL

Histone H4 (tri methyl K20) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details