Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mannan-binding protein (Mbl2)

Product Specifications

Product Name Alternative

(Mannose-binding protein C)

Abbreviation

Recombinant Mouse Mbl2 protein

Gene Name

Mbl2

UniProt

Q3UEK1

Expression Region

19-244aa

Organism

Mus musculus (Mouse)

Target Sequence

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.9 kDa

References & Citations

"Characterization and quantification of mouse mannan-binding lectins (MBL-A and MBL-C) and study of acute phase responses." Liu H., Jensen L., Hansen S., Petersen S.V., Takahashi K., Ezekowitz A.B., Hansen F.D., Jensenius J.C., Thiel S. Scand J Immunol 53:489-497 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant chiken IL2/IL-2/Interleukin-2 protein (His tag)
PDEO100024-01 20 µg

Recombinant chiken IL2/IL-2/Interleukin-2 protein (His tag)

Sign In for Pricing
View Details
Recombinant chiken IL2/IL-2/Interleukin-2 protein (His tag)
PDEO100024-02 100 µg

Recombinant chiken IL2/IL-2/Interleukin-2 protein (His tag)

Sign In for Pricing
View Details
Recombinant chiken IL2/IL-2/Interleukin-2 protein (His tag)
PDEO100024-03 500 µg

Recombinant chiken IL2/IL-2/Interleukin-2 protein (His tag)

Sign In for Pricing
View Details
Recombinant chiken IL2/IL-2/Interleukin-2 protein (His tag)
PDEO100024-04 1 mg

Recombinant chiken IL2/IL-2/Interleukin-2 protein (His tag)

Sign In for Pricing
View Details
SAV1 (NM_021818) Human Over-expression Lysate
LC402881 20 µg

SAV1 (NM_021818) Human Over-expression Lysate

Sign In for Pricing
View Details
Di-n-Butyl Phosphorochloridate
TRC-D429450-5G 5 g

Di-n-Butyl Phosphorochloridate

Sign In for Pricing
View Details