IL-4, Canine
The IL-4 protein actively participates in the B cell activation process, acting as a costimulator for DNA synthesis. It induces the expression of class II MHC molecules on resting B cells, enhances IgE and IgG1 secretion and cell surface expression, and modulates CD23 expression on lymphocytes and monocytes. IL-4 Protein, Canine is the recombinant canine-derived IL-4 protein, expressed by E. coli , with no tag.
Product Specifications
Product Name Alternative
IL-4 Protein, Canine, Canine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-4-protein-canine.html
Purity
97.60
Smiles
HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH
Molecular Formula
403785 (Gene_ID) O77762 (H25-H132) (Accession)
Molecular Weight
Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Guinea pig Olfactory receptor 5D14 (OR5D14) ELISA Kit
Guinea pig Olfactory receptor 5D14 (OR5D14) ELISA Kit
Guinea pig Olfactory receptor 5D14 (OR5D14) ELISA Kit