Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Mouse (HEK293, His)

The G-CSF Protein, a monomeric cytokine in the granulocyte/macrophage colony-stimulating factor family, crucially regulates hematopoiesis by orchestrating the production, differentiation, and function of granulocytes and monocytes-macrophages. Its production emphasizes its significance in maintaining immune system balance and functionality. G-CSF Protein, Mouse (HEK293, His) is the recombinant mouse-derived G-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

G-CSF Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Formula

12985 (Gene_ID) P09920 (V31-A208) (Accession)

Molecular Weight

Approximately 22-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN2A2 Protein Lysate (Human) with C-Ha Tag
13562031 100 µg

BTN2A2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Vil1 (NM_009509) Mouse Tagged ORF Clone
MR210849 10 µg

Vil1 (NM_009509) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
(4-Bromo-3-methoxyphenyl) methanamine hydrochloride
GDD30963-01 250 mg

(4-Bromo-3-methoxyphenyl) methanamine hydrochloride

Sign In for Pricing
View Details
(4-Bromo-3-methoxyphenyl) methanamine hydrochloride
GDD30963-02 2.5 g

(4-Bromo-3-methoxyphenyl) methanamine hydrochloride

Sign In for Pricing
View Details
NUDCD3 Rabbit Polyclonal Antibody (BF750)
orb2521533 100 µL

NUDCD3 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
MYOD1 (Myoblast Determination Protein 1, Class C Basic Helix-loop-helix Protein 1, bHLHc1, Myogenic Factor 3, Myf-3, BHLHC1, MYF3, MYOD) (AP) discontinued
130083-AP 100 µL

MYOD1 (Myoblast Determination Protein 1, Class C Basic Helix-loop-helix Protein 1, bHLHc1, Myogenic Factor 3, Myf-3, BHLHC1, MYF3, MYOD) (AP) discontinued

Sign In for Pricing
View Details