Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA3, Human (His)

PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PSMA3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psma3-protein-human-his.html

Purity

98.00

Smiles

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Molecular Formula

5684 (Gene_ID) P25788-1 (M1-M255) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclophilin A (PPIA) (NM_021130) Human Recombinant Protein
TP303307M 100 µg

Cyclophilin A (PPIA) (NM_021130) Human Recombinant Protein

Sign In for Pricing
View Details
Carbonic Anhydrase II (CA2) Human Gene Knockout Kit (CRISPR)
KN401974 1 Kit

Carbonic Anhydrase II (CA2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF740 conjugate, 0.1mg/mL
BNC742831-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALDH1L1 (C-term) Rabbit Polyclonal Antibody
AP14685PU-N 400 µL

ALDH1L1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS620948 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
CD26 (DPP4) Human Gene Knockout Kit (CRISPR)
KN209466RB 1 Kit

CD26 (DPP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details