Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA3, Human (His)

PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PSMA3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psma3-protein-human-his.html

Purity

98.00

Smiles

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Molecular Formula

5684 (Gene_ID) P25788-1 (M1-M255) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thiamine Monophosphate Dihydrate
TRC-T344142-5G 5 g

Thiamine Monophosphate Dihydrate

Sign In for Pricing
View Details
Recombinant IKAROS Monoclonal Antibody
AN301562L-01 50 µL

Recombinant IKAROS Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant IKAROS Monoclonal Antibody
AN301562L-02 100 µL

Recombinant IKAROS Monoclonal Antibody

Sign In for Pricing
View Details
SNX16 (2-14) Goat Polyclonal Antibody
AP23839PU-N 50 µg

SNX16 (2-14) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Eptinezumab Biosimilar - Research Grade
ICH5044-100mg 100 mg

Eptinezumab Biosimilar - Research Grade

Sign In for Pricing
View Details
MST1 (C-term) Rabbit Polyclonal Antibody
AP52761PU-N 400 µL

MST1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details