Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA3, Human (His)

PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PSMA3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psma3-protein-human-his.html

Purity

98.00

Smiles

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Molecular Formula

5684 (Gene_ID) P25788-1 (M1-M255) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)
MBS1378107-01 0.02 mg (E-Coli)

Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)

Sign In for Pricing
View Details
Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)
MBS1378107-02 0.02 mg (Yeast)

Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)

Sign In for Pricing
View Details
Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)
MBS1378107-03 0.1 mg (E-Coli)

Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)

Sign In for Pricing
View Details
Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)
MBS1378107-04 0.1 mg (Yeast)

Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)

Sign In for Pricing
View Details
Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)
MBS1378107-05 0.02 mg (Baculovirus)

Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)

Sign In for Pricing
View Details
Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)
MBS1378107-06 0.02 mg (Mammalian-Cell)

Recombinant Thermus thermophilus 4-hydroxy-2-oxovalerate aldolase (TTHB246)

Sign In for Pricing
View Details