Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fragile X mental retardation syndrome-related protein 1 (FXR1), partial

Product Specifications

Product Name Alternative

(FMR1 autosomal homolog 1) (hFXR1p)

Abbreviation

Recombinant Human FXR1 protein, partial

Gene Name

FXR1

UniProt

P51114

Expression Region

218-280aa

Organism

Homo sapiens (Human)

Target Sequence

AFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLE

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

RNA-binding protein required for embryonic and postnatal development of muscle tissue . May regulate intracellular transport and local translation of certain mRNAs .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

7.8 kDa

References & Citations

"Recessive mutations in muscle-specific isoforms of FXR1 cause congenital multi-minicore myopathy." Estan M.C., Fernandez-Nunez E., Zaki M.S., Esteban M.I., Donkervoort S., Hawkins C., Caparros-Martin J.A., Saade D., Hu Y., Bolduc V., Chao K.R., Nevado J., Lamuedra A., Largo R., Herrero-Beaumont G., Regadera J., Hernandez-Chico C., Tizzano E.F. Ruiz-Perez V.L. Nat. Commun. 10:797-797 (2019)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arylsulfatase E (ARSE) Antibody (FITC)
abx334726-01 20 µg

Arylsulfatase E (ARSE) Antibody (FITC)

Sign In for Pricing
View Details
Arylsulfatase E (ARSE) Antibody (FITC)
abx334726-02 50 µg

Arylsulfatase E (ARSE) Antibody (FITC)

Sign In for Pricing
View Details
Arylsulfatase E (ARSE) Antibody (FITC)
abx334726-03 100 µg

Arylsulfatase E (ARSE) Antibody (FITC)

Sign In for Pricing
View Details
Arylsulfatase E (ARSE) Antibody (FITC)
abx334726-04 200 µg

Arylsulfatase E (ARSE) Antibody (FITC)

Sign In for Pricing
View Details
Arylsulfatase E (ARSE) Antibody (FITC)
abx334726-05 1 mg

Arylsulfatase E (ARSE) Antibody (FITC)

Sign In for Pricing
View Details
Arcn1 Rat shRNA Plasmid (Locus ID 300674)
TL700849 1 Kit

Arcn1 Rat shRNA Plasmid (Locus ID 300674)

Sign In for Pricing
View Details