Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Human (HEK293, His)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-human-193a-a-hek293-c-his.html

Purity

98.0

Smiles

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Formula

958 (Gene_ID) P25942-1 (E21-R193) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PIGH shRNA Plasmid
abx980078-01 150 µg

Mouse PIGH shRNA Plasmid

Sign In for Pricing
View Details
Mouse PIGH shRNA Plasmid
abx980078-02 300 µg

Mouse PIGH shRNA Plasmid

Sign In for Pricing
View Details
S100b (NM_009115) Mouse Tagged ORF Clone Lentiviral Particle
MR227188L3V 200 µL

S100b (NM_009115) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PORCN (NM_203474) Human Over-expression Lysate
LH16640V 100 µg

PORCN (NM_203474) Human Over-expression Lysate

Sign In for Pricing
View Details
AP2B1 Antibody (Center) Blocking Peptide
MBS9221268-01 0.5 mg

AP2B1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
AP2B1 Antibody (Center) Blocking Peptide
MBS9221268-02 5x 0.5 mg

AP2B1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details