Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Human (HEK293, His)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-human-193a-a-hek293-c-his.html

Purity

98.0

Smiles

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Formula

958 (Gene_ID) P25942-1 (E21-R193) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK12 protein (His tag)
80R-2055 100 ug

MAPK12 protein (His tag)

Sign In for Pricing
View Details
Mouse Monoclonal CNTFR Antibody (MM0190-10L29) [CoraFluor 1]
NBP2-12196CL1 0.1 mL

Mouse Monoclonal CNTFR Antibody (MM0190-10L29) [CoraFluor 1]

Sign In for Pricing
View Details
Bcl2a1d (NM_007536) Mouse Tagged ORF Clone
MR212143 10 µg

Bcl2a1d (NM_007536) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PINK1 Human shRNA Plasmid Kit (Locus ID 65018)
TG320728 1 Kit

PINK1 Human shRNA Plasmid Kit (Locus ID 65018)

Sign In for Pricing
View Details
Mouse Fructose-1, 6-bisphosphatase 1, FBP1 ELISA Kit
MBS166398-01 48 Well

Mouse Fructose-1, 6-bisphosphatase 1, FBP1 ELISA Kit

Sign In for Pricing
View Details
Mouse Fructose-1, 6-bisphosphatase 1, FBP1 ELISA Kit
MBS166398-02 96 Well

Mouse Fructose-1, 6-bisphosphatase 1, FBP1 ELISA Kit

Sign In for Pricing
View Details