Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Human (HEK293, His)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-human-193a-a-hek293-c-his.html

Purity

98.0

Smiles

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Formula

958 (Gene_ID) P25942-1 (E21-R193) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXFP3 Recombinant Protein (Rat)
RP227318 100 µg

RXFP3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
S210 pH meter with InLab Expert Pro-ISM
PHM0053 1 Each

S210 pH meter with InLab Expert Pro-ISM

Sign In for Pricing
View Details
Rat Mrpl1 Pre-designed siRNA Set A
SI208649A 1 Each

Rat Mrpl1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FDPSP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV761384 1.0 µg DNA

FDPSP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Monoclonal UBE2R1/CDC34 Antibody (CPTC-CDC34-2) [Janelia Fluor 646]
NBP3-08839JF646 100 µL

Mouse Monoclonal UBE2R1/CDC34 Antibody (CPTC-CDC34-2) [Janelia Fluor 646]

Sign In for Pricing
View Details
Onyx Ladies Safety Boot Wheat Size 3 - PR
SAF3236 PR

Onyx Ladies Safety Boot Wheat Size 3 - PR

Sign In for Pricing
View Details