Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Human (HEK293, His)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-human-193a-a-hek293-c-his.html

Purity

98.0

Smiles

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Formula

958 (Gene_ID) P25942-1 (E21-R193) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DRAK1 Antibody [Alexa Fluor 488]
NBP1-76896AF488 0.1 mL

Rabbit Polyclonal DRAK1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
PDCL3 sgRNA CRISPR Lentivector (Human) (Target 1)
K1617002 1.0 µg DNA

PDCL3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Bovine Inhibin B(INH-B) ELISA Kit
MBS2609378-01 48 Well

Bovine Inhibin B(INH-B) ELISA Kit

Sign In for Pricing
View Details
Bovine Inhibin B(INH-B) ELISA Kit
MBS2609378-02 96 Well

Bovine Inhibin B(INH-B) ELISA Kit

Sign In for Pricing
View Details
Bovine Inhibin B(INH-B) ELISA Kit
MBS2609378-03 5x 96 Well

Bovine Inhibin B(INH-B) ELISA Kit

Sign In for Pricing
View Details
Bovine Inhibin B(INH-B) ELISA Kit
MBS2609378-04 10x 96 Well

Bovine Inhibin B(INH-B) ELISA Kit

Sign In for Pricing
View Details