Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Human (HEK293, His)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-human-193a-a-hek293-c-his.html

Purity

98.0

Smiles

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Formula

958 (Gene_ID) P25942-1 (E21-R193) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Breast carcinoma amplified sequence 3 Antibody [PE]
NBP2-98807PE 0.1 mL

Rabbit Polyclonal Breast carcinoma amplified sequence 3 Antibody [PE]

Sign In for Pricing
View Details
(S) - (-) -Docosahexaenyl-1'-hydroxy-2'-propylamide
HY-172580 1 Each

(S) - (-) -Docosahexaenyl-1'-hydroxy-2'-propylamide

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable nitrilase C965.09 (SPCC965.09)
MBS1098739-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Probable nitrilase C965.09 (SPCC965.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable nitrilase C965.09 (SPCC965.09)
MBS1098739-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Probable nitrilase C965.09 (SPCC965.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable nitrilase C965.09 (SPCC965.09)
MBS1098739-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Probable nitrilase C965.09 (SPCC965.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable nitrilase C965.09 (SPCC965.09)
MBS1098739-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Probable nitrilase C965.09 (SPCC965.09)

Sign In for Pricing
View Details