Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Human (HEK293, His)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-human-193a-a-hek293-c-his.html

Purity

98.0

Smiles

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Formula

958 (Gene_ID) P25942-1 (E21-R193) (Accession)

Molecular Weight

Approximately 28-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD9, Antibody
GWB-ADF109 0.1 mL

CD9, Antibody

Ask
View Details
Magic™ Membrane Protein Human CLDN10 (Claudin 10) Full Length
MPC0489K Each

Magic™ Membrane Protein Human CLDN10 (Claudin 10) Full Length

Ask
View Details
3’-Hydroxy Diclofenac
TRC-H825725-25MG 25 mg

3’-Hydroxy Diclofenac

Ask
View Details
Lentiviral human DAPL1 shRNA (UAS) - Lentiviral human DAPL1 shRNA (UAS, iRFP) plasmid
GTR15332119 1 Vial

Lentiviral human DAPL1 shRNA (UAS) - Lentiviral human DAPL1 shRNA (UAS, iRFP) plasmid

Ask
View Details
NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (HRP)
MBS6181788-01 0.1 mL

NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (HRP)

Ask
View Details
NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (HRP)
MBS6181788-02 5x 0.1 mL

NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (HRP)

Ask
View Details