Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial

Product Specifications

Product Name Alternative

Heparin-binding protein 44 (HBP-44) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP)

Abbreviation

Recombinant Mouse Lrpap1 protein, partial

Gene Name

Lrpap1

UniProt

P55302

Expression Region

248-360aa

Organism

Mus musculus (Mouse)

Target Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Metabolism

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial
CSB-MP023606MOd9-01 20 µg

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial

Sign In for Pricing
View Details
Recombinant Mouse Toll-like receptor 7 (Tlr7), partial
CSB-MP023606MOd9-02 100 µg

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial

Sign In for Pricing
View Details
Recombinant Mouse Toll-like receptor 7 (Tlr7), partial
CSB-MP023606MOd9-03 1 mg

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial

Sign In for Pricing
View Details
Nori® Rat FGF5 ELISA Kit
GR118101 96 Well

Nori® Rat FGF5 ELISA Kit

Sign In for Pricing
View Details
TROVE2, CT (TROVE2, RO60, SSA2, 60kD SS-A/Ro ribonucleoprotein, Ro 60kD autoantigen, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2) (MaxLight 650)
MBS6358789-01 0.1 mL

TROVE2, CT (TROVE2, RO60, SSA2, 60kD SS-A/Ro ribonucleoprotein, Ro 60kD autoantigen, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2) (MaxLight 650)

Sign In for Pricing
View Details
TROVE2, CT (TROVE2, RO60, SSA2, 60kD SS-A/Ro ribonucleoprotein, Ro 60kD autoantigen, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2) (MaxLight 650)
MBS6358789-02 5x 0.1 mL

TROVE2, CT (TROVE2, RO60, SSA2, 60kD SS-A/Ro ribonucleoprotein, Ro 60kD autoantigen, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2) (MaxLight 650)

Sign In for Pricing
View Details