REG1B, Rhesus Macaque (HEK293, His)
REG1B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived REG1B protein, expressed by HEK293, with C-His labeled tag.
Product Specifications
Product Name Alternative
REG1B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/reg1b-protein-rhesus-macaque-hek293-his.html
Purity
95.00
Smiles
QETQTELPNARISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTEAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDIGAPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN
Molecular Formula
711725 (Gene_ID) NP_001181497.1 (Q23-N166) (Accession)
Molecular Weight
Approximately 17.7 kDa.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470040-500 1x 500 µL
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details