Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG1B, Rhesus Macaque (HEK293, His)

REG1B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived REG1B protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

REG1B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg1b-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QETQTELPNARISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTEAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDIGAPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Molecular Formula

711725 (Gene_ID) NP_001181497.1 (Q23-N166) (Accession)

Molecular Weight

Approximately 17.7 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MS4A3, His-tagged
MS4A3-1049H 25 µg

Recombinant Human MS4A3, His-tagged

Sign In for Pricing
View Details
Rabbit Anti Human P3H2 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424419 Inquire

Rabbit Anti Human P3H2 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
RARRES3 (PLAAT4) (NM_004585) Human Tagged Lenti ORF Clone
RC201923L4 10 µg

RARRES3 (PLAAT4) (NM_004585) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IgG Antibody (heavy chain) (mouse adsorbed)
GWB-Q00100 0.5 mg

IgG Antibody (heavy chain) (mouse adsorbed)

Sign In for Pricing
View Details
FNDC7 (NM_173532) Human Tagged Lenti ORF Clone
RC221414L3 10 µg

FNDC7 (NM_173532) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Uromodulin (UMOD) ELISA Kit
RDR-UMOD-Hu-96Tests 96 Tests

Human Uromodulin (UMOD) ELISA Kit

Sign In for Pricing
View Details