Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG1B, Rhesus Macaque (HEK293, His)

REG1B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived REG1B protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

REG1B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg1b-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QETQTELPNARISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTEAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDIGAPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Molecular Formula

711725 (Gene_ID) NP_001181497.1 (Q23-N166) (Accession)

Molecular Weight

Approximately 17.7 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIG (NM_004792) Human Tagged ORF Clone Lentiviral Particle
RC224587L4V 200 µL

PPIG (NM_004792) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
l Afadin (AFDN) Rabbit Polyclonal Antibody
TA350791 100 µL

l Afadin (AFDN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1000 ug/mLS-Hydroprene in Acetonitrile - 1ML
S-6605 1 mL

1000 ug/mLS-Hydroprene in Acetonitrile - 1ML

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae rpsU Protein (aa 2-71)
VAng-Lsx07178-500gEcoli 500 µg (E. coli)

Recombinant Shigella Dysenteriae rpsU Protein (aa 2-71)

Sign In for Pricing
View Details
Sotigalimab Biosimilar - Research Grade
MBS3030391-01 1 mg

Sotigalimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Sotigalimab Biosimilar - Research Grade
MBS3030391-02 5 mg

Sotigalimab Biosimilar - Research Grade

Sign In for Pricing
View Details