Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG1B, Rhesus Macaque (HEK293, His)

REG1B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived REG1B protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

REG1B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg1b-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QETQTELPNARISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTEAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDIGAPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Molecular Formula

711725 (Gene_ID) NP_001181497.1 (Q23-N166) (Accession)

Molecular Weight

Approximately 17.7 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPPIN Antibody
A53596-50UL 50 μL

EPPIN Antibody

Sign In for Pricing
View Details
Human Soluble FMS-Like Tyrosine Kinase 1 (SFLT-1) ELISA Kit
MBS3800911-01 48 Well

Human Soluble FMS-Like Tyrosine Kinase 1 (SFLT-1) ELISA Kit

Sign In for Pricing
View Details
Human Soluble FMS-Like Tyrosine Kinase 1 (SFLT-1) ELISA Kit
MBS3800911-02 96 Well

Human Soluble FMS-Like Tyrosine Kinase 1 (SFLT-1) ELISA Kit

Sign In for Pricing
View Details
Human Soluble FMS-Like Tyrosine Kinase 1 (SFLT-1) ELISA Kit
MBS3800911-03 5x 96 Well

Human Soluble FMS-Like Tyrosine Kinase 1 (SFLT-1) ELISA Kit

Sign In for Pricing
View Details
Human Soluble FMS-Like Tyrosine Kinase 1 (SFLT-1) ELISA Kit
MBS3800911-04 10x 96 Well

Human Soluble FMS-Like Tyrosine Kinase 1 (SFLT-1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal HLA G Antibody (HLAG/8344R)
NBP3-20480-20ug 20 µg

Rabbit Monoclonal HLA G Antibody (HLAG/8344R)

Sign In for Pricing
View Details