Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG1B, Rhesus Macaque (HEK293, His)

REG1B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived REG1B protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

REG1B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg1b-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QETQTELPNARISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTEAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDIGAPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Molecular Formula

711725 (Gene_ID) NP_001181497.1 (Q23-N166) (Accession)

Molecular Weight

Approximately 17.7 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HIPK3 antibody
STJ191808 200 µl

Anti-HIPK3 antibody

Sign In for Pricing
View Details
Rat Monoclonal CCR1 Antibody (643854R) [Janelia Fluor 669]
FAB5986RJF669 0.1 mL

Rat Monoclonal CCR1 Antibody (643854R) [Janelia Fluor 669]

Sign In for Pricing
View Details
Tsc22d3 Mouse Gene Knockout Kit (CRISPR)
KN318324BN 1 Kit

Tsc22d3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM105B, ID (FAM105B, Protein FAM105B) (MaxLight 405) discontinued
035354-ML405 100 µL

FAM105B, ID (FAM105B, Protein FAM105B) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Boc-D-Asn-OH
sc-234139 5 g

Boc-D-Asn-OH

Sign In for Pricing
View Details
Human TGF-beta receptor type-1, TGFBR1 ELISA KIT
E3312Hu-01 48 Well

Human TGF-beta receptor type-1, TGFBR1 ELISA KIT

Sign In for Pricing
View Details